Lineage for d1hkxj_ (1hkx J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543869Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 2543870Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)
  7. 2543873Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry)
  8. 2543883Domain d1hkxj_: 1hkx J: [83576]
    complexed with cl, dtt, tbr

Details for d1hkxj_

PDB Entry: 1hkx (more details), 2.65 Å

PDB Description: crystal structure of calcium/calmodulin-dependent protein kinase
PDB Compounds: (J:) calcium/calmodulin-dependent protein kinase type II alpha chain

SCOPe Domain Sequences for d1hkxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkxj_ d.17.4.7 (J:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]}
tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
rrdgkwqivhfhrsgapsv

SCOPe Domain Coordinates for d1hkxj_:

Click to download the PDB-style file with coordinates for d1hkxj_.
(The format of our PDB-style files is described here.)

Timeline for d1hkxj_: