PDB entry 1hkx

View 1hkx on RCSB PDB site
Description: crystal structure of calcium/calmodulin-dependent protein kinase
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, calmodulin-binding, phosphorylation, ATP-binding, alternative splicing
Deposited on 2003-03-12, released 2003-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKX (Start-3)
    • Uniprot P11798 (4-End)
    Domains in SCOPe 2.07: d1hkxa_
  • Chain 'B':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxb_
  • Chain 'C':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxc_
  • Chain 'D':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxd_
  • Chain 'E':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKX (0-3)
    • Uniprot P11798 (4-End)
    Domains in SCOPe 2.07: d1hkxe_
  • Chain 'F':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxf_
  • Chain 'G':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxg_
  • Chain 'H':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKX (Start-3)
    • Uniprot P11798 (4-End)
    Domains in SCOPe 2.07: d1hkxh_
  • Chain 'I':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxi_
  • Chain 'J':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxj_
  • Chain 'K':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxk_
  • Chain 'L':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxl_
  • Chain 'M':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxm_
  • Chain 'N':
    Compound: calcium/calmodulin-dependent protein kinase type II alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkxn_
  • Heterogens: DTT, CL, TBR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hkxA (A:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxA (A:)
    mttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldf
    hrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrv
    whrrdgkwqivhfhrsgapsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hkxB (B:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxB (B:)
    dedtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyf
    enlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrd
    gkwqivhfhrsgapsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hkxC (C:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxC (C:)
    tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
    fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
    rrdgkwqivhfhrsgapsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hkxD (D:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxD (D:)
    iededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrf
    yfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhr
    rdgkwqivhfhrsgapsv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hkxE (E:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxE (E:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hkxF (F:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxF (F:)
    tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
    fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
    rrdgkwqivhfhrsgapsv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hkxG (G:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxG (G:)
    dedtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyf
    enlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrd
    gkwqivhfhrsgapsv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hkxH (H:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxH (H:)
    phmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegl
    dfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseet
    rvwhrrdgkwqivhfhrsgapsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1hkxI (I:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxI (I:)
    edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqivhfhrsgapsv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1hkxJ (J:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxJ (J:)
    tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
    fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
    rrdgkwqivhfhrsgapsv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hkxK (K:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxK (K:)
    edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqivhfhrsgapsv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1hkxL (L:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxL (L:)
    edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqivhfhrsgapsv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1hkxM (M:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxM (M:)
    tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
    fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
    rrdgkwqivhfhrsgapsv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1hkxN (N:)
    gphmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlveg
    ldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqsee
    trvwhrrdgkwqivhfhrsgapsvlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkxN (N:)
    dedtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyf
    enlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrd
    gkwqivhfhrsgapsv