SCOPe 2.07: Domain d1h4ax1: 1h4a X:1-85

Lineage for d1h4ax1 (1h4a X:1-85)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Human (Homo sapiens), isoform D [TaxId:9606] [89230] (2 PDB entries)

8. Domain d1h4ax1: 1h4a X:1-85 [83479]
   mutant

Details for d1h4ax1

PDB Entry: 1h4a, 1.15 Å

PDB Description: human gammad crystallin r58h mutant structure at 1.15 a resolution

PDB Compounds: (X:) gamma crystallin d

SCOPe Domain Sequences for d1h4ax1:

Sequence; same for both SEQRES and ATOM records:

>d1h4ax1 b.11.1.1 (X:1-85) gamma-Crystallin {Human (Homo sapiens), isoform D [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcwmlyeqpnysglqyflhrg
dyadhqqwmglsdsvrscrliphsg

Timeline for d1h4ax1:

• d1h4ax1 first appeared in SCOP 1.65
  
• d1h4ax1 appears in SCOPe 2.06
  
• d1h4ax1 appears in the current release, SCOPe 2.08