PDB entry 1h4a

View 1h4a on RCSB PDB site
Description: human gamma-d crystallin r58h mutant structure at 1.15 a resolution
Class: eye lens protein
Keywords: eye lens protein, crystallin
Deposited on 2003-02-25, released 2003-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.157
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gamma crystallin d
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07320 (85-172)
      • engineered mutation (57)
    Domains in SCOPe 2.07: d1h4ax1, d1h4ax2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h4aX (X:)
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcwmlyeqpnysglqyflhrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs