![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
![]() | Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) ![]() |
![]() | Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein) |
![]() | Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63740] (15 PDB entries) Uniprot P09960 |
![]() | Domain d1gw6a2: 1gw6 A:1-208 [83343] Other proteins in same PDB: d1gw6a1, d1gw6a3 complexed with act, bes, imd, yb, zn; mutant |
PDB Entry: 1gw6 (more details), 2.2 Å
SCOPe Domain Sequences for d1gw6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw6a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd pedpsrkiykfiqkvpipcylialvvga
Timeline for d1gw6a2: