PDB entry 1gw6

View 1gw6 on RCSB PDB site
Description: structure of leukotriene a4 hydrolase d375n mutant
Class: hydrolase
Keywords: hydrolase, mutagenesis studies, alpha-beta protein
Deposited on 2002-03-07, released 2003-03-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09960 (0-609)
      • engineered mutation (374)
    Domains in SCOPe 2.01: d1gw6a1, d1gw6a2, d1gw6a3
  • Heterogens: BES, ACT, IMD, YB, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw6A (A:)
    peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
    iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
    eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
    pedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesm
    lkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishs
    wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgeth
    pftklvvdltdidpnvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksit
    tddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitake
    ddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlr
    lciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvta
    mlvgkdlkvd