SCOPe 2.08: Domain d1ga2a2: 1ga2 A:457-614

Lineage for d1ga2a2 (1ga2 A:457-614)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)

7. Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries)
   endoglucanase 9G

8. Domain d1ga2a2: 1ga2 A:457-614 [83282]
   Other proteins in same PDB: d1ga2a1, d1ga2b1
   complexed with acy, ca, gol, mg

Details for d1ga2a2

PDB Entry: 1ga2, 1.7 Å

PDB Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum complexed with cellobiose

PDB Compounds: (A:) endoglucanase 9g

SCOPe Domain Sequences for d1ga2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ga2a2 b.2.2.2 (A:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt
ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty
wnpkndfsydglpttstvntvtnipvydngvkvfgnep

Timeline for d1ga2a2:

• d1ga2a2 first appeared in SCOP 1.65
  
• d1ga2a2 appears in SCOPe 2.07