Lineage for d1ga2b1 (1ga2 B:2-456)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722090Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 2722091Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89107] (4 PDB entries)
    endoglucanase 9G
  8. 2722093Domain d1ga2b1: 1ga2 B:2-456 [83283]
    Other proteins in same PDB: d1ga2a2, d1ga2b2
    complexed with acy, ca, gol, mg

Details for d1ga2b1

PDB Entry: 1ga2 (more details), 1.7 Å

PDB Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum complexed with cellobiose
PDB Compounds: (B:) endoglucanase 9g

SCOPe Domain Sequences for d1ga2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ga2b1 a.102.1.2 (B:2-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
acdynagftgalakmykhsggdpipnfkaiekitn

SCOPe Domain Coordinates for d1ga2b1:

Click to download the PDB-style file with coordinates for d1ga2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ga2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ga2b2