Lineage for d1fb9a_ (1fb9 A:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 528507Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 528508Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 528509Family j.6.1.1: Peptide hormones [58285] (17 proteins)
  6. 528510Protein Calcitonin [58301] (2 species)
  7. 528515Species Pink salmon (Oncorhynchus gorbuscha) [TaxId:8017] [90268] (1 PDB entry)
  8. 528516Domain d1fb9a_: 1fb9 A: [83250]

Details for d1fb9a_

PDB Entry: 1fb9 (more details)

PDB Description: effects of s-sulfonation on the solution structure of salmon calcitonin

SCOP Domain Sequences for d1fb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb9a_ j.6.1.1 (A:) Calcitonin {Pink salmon (Oncorhynchus gorbuscha)}
csnlstcvlgklsqelhklqtyprtntgsgtp

SCOP Domain Coordinates for d1fb9a_:

Click to download the PDB-style file with coordinates for d1fb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fb9a_: