PDB entry 1fb9

View 1fb9 on RCSB PDB site
Description: effects of s-sulfonation on the solution structure of salmon calcitonin
Deposited on 2000-07-14, released 2003-07-01
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fb9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb9A (A:)
    csnlstcvlgklsqelhklqtyprtntgsgtp