Lineage for d1b2d.1 (1b2d B:,A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061256Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1061257Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1061258Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1061263Protein Insulin [56996] (3 species)
  7. 1061428Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 1061441Domain d1b2d.1: 1b2d B:,A: [83154]
    complexed with so4

Details for d1b2d.1

PDB Entry: 1b2d (more details), 1.7 Å

PDB Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 6.35 coordinates)
PDB Compounds: (A:) PROTEIN (INSULIN A chain), (B:) PROTEIN (INSULIN b chain)

SCOPe Domain Sequences for d1b2d.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b2d.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1b2d.1:

Click to download the PDB-style file with coordinates for d1b2d.1.
(The format of our PDB-style files is described here.)

Timeline for d1b2d.1: