Lineage for d1b2d.1 (1b2d B:,A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. Protein Insulin [56996] (3 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. Domain d1b2d.1: 1b2d B:,A: [83154]
    complexed with so4

Details for d1b2d.1

PDB Entry: 1b2d (more details), 1.7 Å

PDB Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 6.35 coordinates)
PDB Compounds: (A:) PROTEIN (INSULIN A chain), (B:) PROTEIN (INSULIN b chain)

SCOPe Domain Sequences for d1b2d.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b2d.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1b2d.1 are not available.

Timeline for d1b2d.1: