SCOPe 2.08: Domain d2rr1.1: 2rr1 4:,2:

Lineage for d2rr1.1 (2rr1 4:,2:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (36 PDB entries)

8. Domain d2rr1.1: 2rr1 4:,2: [83143]
   complexed with w8r

Details for d2rr1.1

PDB Entry: 2rr1, 3 Å

PDB Description: structural analysis of antiviral agents that interact with the capsid of human rhinoviruses

PDB Compounds: (2:) human rhinovirus 14 coat protein (subunit vp2), (4:) human rhinovirus 14 coat protein (subunit vp4)

SCOPe Domain Sequences for d2rr1.1:

Sequence; same for both SEQRES and ATOM records:

>g2rr1.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
inyykdaastssagqslsmdpskftepvkdlmlkgapalnXgysdrvqqitlgnstittq
eaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytldsktwttgskgwcwklpdal
kdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvipehqlasheggnvsvkytf
thpgergidlssanevggpvkdvlynmngtllgnllifphqfinlrtnntativipyins
vpidsmtrhnnvslmvipiapltvptgatpslpitvtiapmctefsgirsksivpq

Timeline for d2rr1.1:

• d2rr1.1 first appeared in SCOP 1.65
  
• d2rr1.1 appears in SCOPe 2.07