Lineage for d1o95d_ (1o95 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591052Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1591053Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 1591057Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)
  8. 1591069Domain d1o95d_: 1o95 D: [81217]
    Other proteins in same PDB: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95c_, d1o95e_
    complexed with adp, amp, fmn, sf4

Details for d1o95d_

PDB Entry: 1o95 (more details), 3.7 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (D:) electron transfer flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o95d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o95d_ c.26.2.3 (D:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv

SCOPe Domain Coordinates for d1o95d_:

Click to download the PDB-style file with coordinates for d1o95d_.
(The format of our PDB-style files is described here.)

Timeline for d1o95d_: