| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding the first three families are more closely related to each other as the last two families are |
| Family c.26.2.3: ETFP subunits [52432] (2 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding fomain of DHS-like fold |
| Species Methylophilus methylotrophus [TaxId:17] [82362] (4 PDB entries) |
| Domain d1o95d_: 1o95 D: [81217] Other proteins in same PDB: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95c_, d1o95e_ |
PDB Entry: 1o95 (more details), 3.7 Å
SCOP Domain Sequences for d1o95d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o95d_ c.26.2.3 (D:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv
Timeline for d1o95d_: