Lineage for d1o8ua_ (1o8u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853070Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 2853071Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. 2853084Domain d1o8ua_: 1o8u A: [81194]
    complexed with na

Details for d1o8ua_

PDB Entry: 1o8u (more details), 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily
PDB Compounds: (A:) 6-oxo camphor hydrolase

SCOPe Domain Sequences for d1o8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8ua_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidlg

SCOPe Domain Coordinates for d1o8ua_:

Click to download the PDB-style file with coordinates for d1o8ua_.
(The format of our PDB-style files is described here.)

Timeline for d1o8ua_: