PDB entry 1o8u

View 1o8u on RCSB PDB site
Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily
Class: hydrolase
Keywords: hydrolase, crotonase, terpene metabolism, rhodococcuse
Deposited on 2002-12-04, released 2003-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8ua_
  • Chain 'B':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8ub_
  • Chain 'C':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8uc_
  • Chain 'D':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8ud_
  • Chain 'E':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8ue_
  • Chain 'F':
    Compound: 6-oxo camphor hydrolase
    Species: RHODOCOCCUS ERYTHROPOLIS [TaxId:1833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8uf_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o8uA (A:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uA (A:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o8uB (B:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uB (B:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o8uC (C:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uC (C:)
    tpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvvi
    ltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpei
    pvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldartal
    dygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahea
    laaidlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o8uD (D:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uD (D:)
    tpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvvi
    ltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpei
    pvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldartal
    dygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahea
    laaidlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o8uE (E:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uE (E:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1o8uF (F:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    nhpeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8uF (F:)
    atpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvv
    iltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpe
    ipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldarta
    ldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahe
    alaaidlg