SCOP 1.71: Domain d1o7xd_: 1o7x D:

Lineage for d1o7xd_ (1o7x D:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81861] (1 PDB entry)

8. Domain d1o7xd_: 1o7x D: [81174]

Details for d1o7xd_

PDB Entry: 1o7x, 2.7 Å

PDB Description: citrate synthase from sulfolobus solfataricus

SCOP Domain Sequences for d1o7xd_:

Sequence; same for both SEQRES and ATOM records:

>d1o7xd_ a.103.1.1 (D:) Citrate synthase {Archaeon Sulfolobus solfataricus}
vvskglenviikvtnltfidgekgilryrgyniedlvnygsyeetiylmlygklptkkel
ndlkaklneeyevpqevldtiylmpkeadaigllevgtaalasidknfkwkendkekais
iiakmatlvanvyrrkegnkpripepsdsfaksfllasfarepttdeinamdkalilytd
hevpasttaalvaastlsdmyssltaalaalkgplhggaaeeafkqfieigdpnrvqnwf
ndkvvnqknrlmgfghrvyktydprakifkklaltliernadarryfeiaqkleelgikq
fsskgiypntdfysgivfyalgfpvymftalfalsrtlgwlahiieyveeqhrlirpral
yvgpe

Timeline for d1o7xd_:

• d1o7xd_ first appeared in SCOP 1.63
  
• d1o7xd_ appears in SCOP 1.69
  
• d1o7xd_ appears in SCOP 1.73
  
• d1o7xd_ appears in the current release, SCOPe 2.08