Class a: All alpha proteins [46456] (226 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (1 family) |
Family a.103.1.1: Citrate synthase [48257] (1 protein) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain |
Protein Citrate synthase [48258] (7 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81861] (1 PDB entry) |
Domain d1o7xd_: 1o7x D: [81174] |
PDB Entry: 1o7x (more details), 2.7 Å
SCOP Domain Sequences for d1o7xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7xd_ a.103.1.1 (D:) Citrate synthase {Archaeon Sulfolobus solfataricus} vvskglenviikvtnltfidgekgilryrgyniedlvnygsyeetiylmlygklptkkel ndlkaklneeyevpqevldtiylmpkeadaigllevgtaalasidknfkwkendkekais iiakmatlvanvyrrkegnkpripepsdsfaksfllasfarepttdeinamdkalilytd hevpasttaalvaastlsdmyssltaalaalkgplhggaaeeafkqfieigdpnrvqnwf ndkvvnqknrlmgfghrvyktydprakifkklaltliernadarryfeiaqkleelgikq fsskgiypntdfysgivfyalgfpvymftalfalsrtlgwlahiieyveeqhrlirpral yvgpe
Timeline for d1o7xd_: