Lineage for d1o7xb_ (1o7x B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542199Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 542200Superfamily a.103.1: Citrate synthase [48256] (1 family) (S)
  5. 542201Family a.103.1.1: Citrate synthase [48257] (1 protein)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
  6. 542202Protein Citrate synthase [48258] (7 species)
  7. 542208Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81861] (1 PDB entry)
  8. 542210Domain d1o7xb_: 1o7x B: [81172]

Details for d1o7xb_

PDB Entry: 1o7x (more details), 2.7 Å

PDB Description: citrate synthase from sulfolobus solfataricus

SCOP Domain Sequences for d1o7xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7xb_ a.103.1.1 (B:) Citrate synthase {Archaeon Sulfolobus solfataricus}
vvskglenviikvtnltfidgekgilryrgyniedlvnygsyeetiylmlygklptkkel
ndlkaklneeyevpqevldtiylmpkeadaigllevgtaalasidknfkwkendkekais
iiakmatlvanvyrrkegnkpripepsdsfaksfllasfarepttdeinamdkalilytd
hevpasttaalvaastlsdmyssltaalaalkgplhggaaeeafkqfieigdpnrvqnwf
ndkvvnqknrlmgfghrvyktydprakifkklaltliernadarryfeiaqkleelgikq
fsskgiypntdfysgivfyalgfpvymftalfalsrtlgwlahiieyveeqhrlirpral
yvgpey

SCOP Domain Coordinates for d1o7xb_:

Click to download the PDB-style file with coordinates for d1o7xb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7xb_: