![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (1 family) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (1 protein) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain |
![]() | Protein Citrate synthase [48258] (7 species) |
![]() | Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81861] (1 PDB entry) |
![]() | Domain d1o7xa_: 1o7x A: [81171] |
PDB Entry: 1o7x (more details), 2.7 Å
SCOP Domain Sequences for d1o7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7xa_ a.103.1.1 (A:) Citrate synthase {Archaeon Sulfolobus solfataricus} vvskglenviikvtnltfidgekgilryrgyniedlvnygsyeetiylmlygklptkkel ndlkaklneeyevpqevldtiylmpkeadaigllevgtaalasidknfkwkendkekais iiakmatlvanvyrrkegnkpripepsdsfaksfllasfarepttdeinamdkalilytd hevpasttaalvaastlsdmyssltaalaalkgplhggaaeeafkqfieigdpnrvqnwf ndkvvnqknrlmgfghrvyktydprakifkklaltliernadarryfeiaqkleelgikq fsskgiypntdfysgivfyalgfpvymftalfalsrtlgwlahiieyveeqhrlirpral yvgpeyq
Timeline for d1o7xa_: