Lineage for d1o7lc3 (1o7l C:200-261)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400579Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2400626Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. 2400627Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 2400628Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 2400650Domain d1o7lc3: 1o7l C:200-261 [81155]
    Other proteins in same PDB: d1o7la1, d1o7lb1, d1o7lc1, d1o7ld1
    molybdate-activated form
    complexed with ca, cl, moo

Details for d1o7lc3

PDB Entry: 1o7l (more details), 2.75 Å

PDB Description: molybdate-activated form of mode from escherichia coli
PDB Compounds: (C:) transcriptional regulator mode

SCOPe Domain Sequences for d1o7lc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7lc3 b.40.6.2 (C:200-261) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
tl

SCOPe Domain Coordinates for d1o7lc3:

Click to download the PDB-style file with coordinates for d1o7lc3.
(The format of our PDB-style files is described here.)

Timeline for d1o7lc3: