SCOPe 2.07: Domain d1o7lc1: 1o7l C:2-126

Lineage for d1o7lc1 (1o7l C:2-126)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)
   contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension

6. Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)

7. Species Escherichia coli [TaxId:562] [46812] (3 PDB entries)

8. Domain d1o7lc1: 1o7l C:2-126 [81153]
   Other proteins in same PDB: d1o7la2, d1o7la3, d1o7lb2, d1o7lb3, d1o7lc2, d1o7lc3, d1o7ld2, d1o7ld3
   molybdate-activated form
   complexed with ca, cl, moo

Details for d1o7lc1

PDB Entry: 1o7l, 2.75 Å

PDB Description: molybdate-activated form of mode from escherichia coli

PDB Compounds: (C:) transcriptional regulator mode

SCOPe Domain Sequences for d1o7lc1:

Sequence, based on SEQRES records:

>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh
ilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrf
slqts

Sequence, based on observed residues (ATOM records):

>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh
ilverggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts

Timeline for d1o7lc1:

• d1o7lc1 first appeared in SCOP 1.63
  
• d1o7lc1 appears in SCOPe 2.06
  
• d1o7lc1 appears in the current release, SCOPe 2.08