Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein) contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension |
Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species) |
Species Escherichia coli [TaxId:562] [46812] (3 PDB entries) |
Domain d1o7lc1: 1o7l C:2-126 [81153] Other proteins in same PDB: d1o7la2, d1o7la3, d1o7lb2, d1o7lb3, d1o7lc2, d1o7lc3, d1o7ld2, d1o7ld3 molybdate-activated form complexed with ca, cl, moo |
PDB Entry: 1o7l (more details), 2.75 Å
SCOPe Domain Sequences for d1o7lc1:
Sequence, based on SEQRES records: (download)
>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh ilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrf slqts
>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh ilverggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts
Timeline for d1o7lc1: