Lineage for d1o7lc1 (1o7l C:2-126)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079565Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)
    contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension
  6. 1079566Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)
  7. 1079567Species Escherichia coli [TaxId:562] [46812] (3 PDB entries)
  8. 1079574Domain d1o7lc1: 1o7l C:2-126 [81153]
    Other proteins in same PDB: d1o7la2, d1o7la3, d1o7lb2, d1o7lb3, d1o7lc2, d1o7lc3, d1o7ld2, d1o7ld3
    molybdate-activated form
    complexed with ca, cl, moo

Details for d1o7lc1

PDB Entry: 1o7l (more details), 2.75 Å

PDB Description: molybdate-activated form of mode from escherichia coli
PDB Compounds: (C:) transcriptional regulator mode

SCOPe Domain Sequences for d1o7lc1:

Sequence, based on SEQRES records: (download)

>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh
ilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrf
slqts

Sequence, based on observed residues (ATOM records): (download)

>d1o7lc1 a.4.5.8 (C:2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
qaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlseh
ilverggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts

SCOPe Domain Coordinates for d1o7lc1:

Click to download the PDB-style file with coordinates for d1o7lc1.
(The format of our PDB-style files is described here.)

Timeline for d1o7lc1: