Lineage for d1o7la2 (1o7l A:127-199)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1125780Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 1125827Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
  6. 1125828Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 1125829Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)
  8. 1125846Domain d1o7la2: 1o7l A:127-199 [81148]
    Other proteins in same PDB: d1o7la1, d1o7lb1, d1o7lc1, d1o7ld1
    molybdate-activated form
    complexed with ca, cl, moo

Details for d1o7la2

PDB Entry: 1o7l (more details), 2.75 Å

PDB Description: molybdate-activated form of mode from escherichia coli
PDB Compounds: (A:) transcriptional regulator mode

SCOPe Domain Sequences for d1o7la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7la2 b.40.6.2 (A:127-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
arnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapw
vgitqdeavaqna

SCOPe Domain Coordinates for d1o7la2:

Click to download the PDB-style file with coordinates for d1o7la2.
(The format of our PDB-style files is described here.)

Timeline for d1o7la2: