SCOP 1.63: Domain d1o7ga2: 1o7g A:155-448

Lineage for d1o7ga2 (1o7g A:155-448)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (4 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55969] (1 protein)
   contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species)

7. Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries)

8. Domain d1o7ga2: 1o7g A:155-448 [81135]
   Other proteins in same PDB: d1o7ga1, d1o7gb_
   complexed with edo, fe, fes, npy, so4

Details for d1o7ga2

PDB Entry: 1o7g, 1.7 Å

PDB Description: naphthalene 1,2-dioxygenase with naphthalene bound in the active site.

SCOP Domain Sequences for d1o7ga2:

Sequence; same for both SEQRES and ATOM records:

>d1o7ga2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd

Timeline for d1o7ga2:

• d1o7ga2 is new in SCOP 1.63
  
• d1o7ga2 appears in SCOP 1.65
  
• d1o7ga2 appears in the current release, SCOPe 2.08