Lineage for d1o78a_ (1o78 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082732Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2082733Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2082734Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species)
  7. 2082735Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries)
  8. 2082738Domain d1o78a_: 1o78 A: [81130]
    mutant

Details for d1o78a_

PDB Entry: 1o78 (more details)

PDB Description: biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
PDB Compounds: (A:) biotin carboxyl carrier protein of methylmalonyl-coa carboxyl-transferase

SCOPe Domain Sequences for d1o78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o78a_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
mklkvtvngagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptd
gkvekvlvkerdavqggqglikig

SCOPe Domain Coordinates for d1o78a_:

Click to download the PDB-style file with coordinates for d1o78a_.
(The format of our PDB-style files is described here.)

Timeline for d1o78a_: