|  | Class b: All beta proteins [48724] (177 folds) | 
|  | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets | 
|  | Superfamily b.84.1: Single hybrid motif [51230] (2 families)  7 to 8 strands in 2 beta-sheets | 
|  | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) | 
|  | Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species) | 
|  | Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries) | 
|  | Domain d1o78a_: 1o78 A: [81130] mutant | 
PDB Entry: 1o78 (more details)
SCOPe Domain Sequences for d1o78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o78a_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
mklkvtvngagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptd
gkvekvlvkerdavqggqglikig
Timeline for d1o78a_: