Lineage for d1o6za2 (1o6z A:163-330)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2605078Protein Malate dehydrogenase [56329] (12 species)
  7. 2605126Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)
  8. 2605127Domain d1o6za2: 1o6z A:163-330 [81108]
    Other proteins in same PDB: d1o6za1, d1o6zb1, d1o6zc1, d1o6zd1
    complexed with cl, nad; mutant

Details for d1o6za2

PDB Entry: 1o6z (more details), 1.95 Å

PDB Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1o6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvsvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvslgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d1o6za2:

Click to download the PDB-style file with coordinates for d1o6za2.
(The format of our PDB-style files is described here.)

Timeline for d1o6za2: