Lineage for d1o1ua_ (1o1u A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1552171Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1552329Protein Ileal lipid-binding protein [50870] (2 species)
  7. 1552330Species Human (Homo sapiens) [TaxId:9606] [82159] (3 PDB entries)
  8. 1552333Domain d1o1ua_: 1o1u A: [81076]

Details for d1o1ua_

PDB Entry: 1o1u (more details)

PDB Description: human ileal lipid-binding protein (ilbp) in free form
PDB Compounds: (A:) Gastrotropin

SCOPe Domain Sequences for d1o1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ua_ b.60.1.2 (A:) Ileal lipid-binding protein {Human (Homo sapiens) [TaxId: 9606]}
aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt
nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye
rvskrla

SCOPe Domain Coordinates for d1o1ua_:

Click to download the PDB-style file with coordinates for d1o1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ua_: