Class b: All beta proteins [48724] (119 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (3 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Ileal lipid-binding protein [50870] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82159] (2 PDB entries) |
Domain d1o1ua_: 1o1u A: [81076] |
PDB Entry: 1o1u (more details)
SCOP Domain Sequences for d1o1ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1ua_ b.60.1.2 (A:) Ileal lipid-binding protein {Human (Homo sapiens)} aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye rvskrla
Timeline for d1o1ua_: