Lineage for d1o1ua_ (1o1u A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232449Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 232450Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 232615Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 232687Protein Ileal lipid-binding protein [50870] (2 species)
  7. 232688Species Human (Homo sapiens) [TaxId:9606] [82159] (2 PDB entries)
  8. 232690Domain d1o1ua_: 1o1u A: [81076]

Details for d1o1ua_

PDB Entry: 1o1u (more details)

PDB Description: human ileal lipid-binding protein (ilbp) in free form

SCOP Domain Sequences for d1o1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ua_ b.60.1.2 (A:) Ileal lipid-binding protein {Human (Homo sapiens)}
aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt
nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye
rvskrla

SCOP Domain Coordinates for d1o1ua_:

Click to download the PDB-style file with coordinates for d1o1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ua_: