SCOP 1.63: Domain d1o17b1: 1o17 B:1-70

Lineage for d1o17b1 (1o17 B:1-70)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family)

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (2 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (1 PDB entry)

8. Domain d1o17b1: 1o17 B:1-70 [80767]
   Other proteins in same PDB: d1o17a2, d1o17b2, d1o17c2, d1o17d2

Details for d1o17b1

PDB Entry: 1o17, 2.05 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd)

SCOP Domain Sequences for d1o17b1:

Sequence; same for both SEQRES and ATOM records:

>d1o17b1 a.46.2.1 (B:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d1o17b1:

• d1o17b1 is new in SCOP 1.63
  
• d1o17b1 appears in SCOP 1.65
  
• d1o17b1 appears in the current release, SCOPe 2.08