Lineage for d1o17c2 (1o17 C:71-345)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242372Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 242373Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family) (S)
  5. 242374Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)
  6. 242375Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (2 species)
  7. 242376Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82365] (1 PDB entry)
  8. 242379Domain d1o17c2: 1o17 C:71-345 [80770]
    Other proteins in same PDB: d1o17a1, d1o17b1, d1o17c1, d1o17d1

Details for d1o17c2

PDB Entry: 1o17 (more details), 2.05 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd)

SCOP Domain Sequences for d1o17c2:

Sequence, based on SEQRES records: (download)

>d1o17c2 c.27.1.1 (C:71-345) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus}
vpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvkssg

Sequence, based on observed residues (ATOM records): (download)

>d1o17c2 c.27.1.1 (C:71-345) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus}
vpnaidtagglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgyniivppe
rakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlmgvfs
kdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtdfgis
pipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregyeyadh
lieksldklneiismngdvtklktivvkssg

SCOP Domain Coordinates for d1o17c2:

Click to download the PDB-style file with coordinates for d1o17c2.
(The format of our PDB-style files is described here.)

Timeline for d1o17c2: