Lineage for d1nwgc_ (1nwg C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924220Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2924253Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)
  8. 2924281Domain d1nwgc_: 1nwg C: [80739]
    Other proteins in same PDB: d1nwgb_, d1nwgd_
    complexed with bgn, ca

Details for d1nwgc_

PDB Entry: 1nwg (more details), 2.32 Å

PDB Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and n- butanoyl-glucoamine
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1nwgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwgc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1nwgc_:

Click to download the PDB-style file with coordinates for d1nwgc_.
(The format of our PDB-style files is described here.)

Timeline for d1nwgc_: