Lineage for d1nmub_ (1nmu B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258900Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 258984Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 258985Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 258986Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (1 species)
  7. 258987Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (8 PDB entries)
  8. 258995Domain d1nmub_: 1nmu B: [80666]
    Other proteins in same PDB: d1nmua_, d1nmuc_

Details for d1nmub_

PDB Entry: 1nmu (more details), 2.31 Å

PDB Description: mbp-l30

SCOP Domain Sequences for d1nmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmub_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae)}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla

SCOP Domain Coordinates for d1nmub_:

Click to download the PDB-style file with coordinates for d1nmub_.
(The format of our PDB-style files is described here.)

Timeline for d1nmub_: