Lineage for d1nlwe_ (1nlw E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2709990Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2709995Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 2709996Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 2710000Domain d1nlwe_: 1nlw E: [80636]
    Other proteins in same PDB: d1nlwa_, d1nlwd_
    complexed with Mad
    protein/DNA complex

Details for d1nlwe_

PDB Entry: 1nlw (more details), 2 Å

PDB Description: crystal structure of mad-max recognizing dna
PDB Compounds: (E:) max protein

SCOPe Domain Sequences for d1nlwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlwe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
ddlkrqnalleqqv

SCOPe Domain Coordinates for d1nlwe_:

Click to download the PDB-style file with coordinates for d1nlwe_.
(The format of our PDB-style files is described here.)

Timeline for d1nlwe_: