| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
| Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins) |
| Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
| Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries) |
| Domain d1nkpb_: 1nkp B: [80574] Other proteins in same PDB: d1nkpa_, d1nkpd_ |
PDB Entry: 1nkp (more details), 1.8 Å
SCOP Domain Sequences for d1nkpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
qdiddlkrqnalleqqvralggc
Timeline for d1nkpb_: