SCOP 1.71: Domain d1nkpa_: 1nkp A:

Lineage for d1nkpa_ (1nkp A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein Myc proto-oncogene protein [81750] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry)
   BHLHZ region; contains leucine-zipper motif

8. Domain d1nkpa_: 1nkp A: [80573]
   Other proteins in same PDB: d1nkpb_, d1nkpe_

Details for d1nkpa_

PDB Entry: 1nkp, 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

SCOP Domain Sequences for d1nkpa_:

Sequence; same for both SEQRES and ATOM records:

>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens)}
ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae
eqkliseedllrkrreqlkhkleqlggc

Timeline for d1nkpa_:

• d1nkpa_ first appeared in SCOP 1.63
  
• d1nkpa_ appears in SCOP 1.69
  
• d1nkpa_ appears in SCOP 1.73
  
• d1nkpa_ appears in the current release, SCOPe 2.08, called d1nkpa1