Lineage for d1nkpb_ (1nkp B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355126Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 355127Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 355128Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 355133Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 355134Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 355135Domain d1nkpb_: 1nkp B: [80574]
    Other proteins in same PDB: d1nkpa_, d1nkpd_

Details for d1nkpb_

PDB Entry: 1nkp (more details), 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

SCOP Domain Sequences for d1nkpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
qdiddlkrqnalleqqvralggc

SCOP Domain Coordinates for d1nkpb_:

Click to download the PDB-style file with coordinates for d1nkpb_.
(The format of our PDB-style files is described here.)

Timeline for d1nkpb_: