PDB entry 1nkp

View 1nkp on RCSB PDB site
Description: crystal structure of myc-max recognizing dna
Deposited on 2003-01-03, released 2003-02-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nkpa_
  • Chain 'B':
    Domains in SCOP 1.67: d1nkpb_
  • Chain 'D':
    Domains in SCOP 1.67: d1nkpd_
  • Chain 'E':
    Domains in SCOP 1.67: d1nkpe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkpA (A:)
    ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae
    eqkliseedllrkrreqlkhkleqlggc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkpB (B:)
    dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
    qdiddlkrqnalleqqvralggc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nkpD (D:)
    ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae
    eqkliseedllrkrreqlkhkleqlggc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkpD (D:)
    mnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeq
    kliseedllrkrreqlkhkleql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nkpE (E:)
    dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
    qdiddlkrqnalleqqvralggc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkpE (E:)
    rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd
    iddlkrqnalleqqvralggc