SCOPe 2.08: Domain d1ni3a1: 1ni3 A:11-306

Lineage for d1ni3a1 (1ni3 A:11-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein YchF GTP-binding protein N-terminal domain [82410] (2 species)
   Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82411] (1 PDB entry)

8. Domain d1ni3a1: 1ni3 A:11-306 [80531]
   Other proteins in same PDB: d1ni3a2
   complexed with so4
   has additional subdomain(s) that are not in the common domain

Details for d1ni3a1

PDB Entry: 1ni3, 2.8 Å

PDB Description: structure of the schizosaccharomyces pombe ychf gtpase

PDB Compounds: (A:) YchF GTP-binding protein

SCOPe Domain Sequences for d1ni3a1:

Sequence; same for both SEQRES and ATOM records:

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
kvqwgrpgnnlktgivgmpnvgkstffraitksvlgnpanypyatidpeeakvavpderf
dwlceaykpksrvpafltvfdiagltkgastgvglgnaflshvravdaiyqvvrafddae
iihvegdvdpirdlsiivdellikdaefvekhleglrkitsrgantlemkakkeeqaiie
kvyqyltetkqpirkgdwsnreveiinslylltakpviylvnmserdflrqknkylpkik
kwidenspgdtlipmsvafeerltnfteeeaieeckklntksmlpkiivtgynaln

Timeline for d1ni3a1:

• d1ni3a1 first appeared in SCOP 1.63
  
• d1ni3a1 appears in SCOPe 2.07