| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Succinate dehydogenase [81669] (3 species) |
| Species Escherichia coli [TaxId:562] [81670] (5 PDB entries) |
| Domain d1nekb1: 1nek B:107-238 [80429] Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb2, d1nekc_, d1nekd_ complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2 |
PDB Entry: 1nek (more details), 2.6 Å
SCOPe Domain Sequences for d1nekb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna
Timeline for d1nekb1: