Lineage for d1ndfa2 (1ndf A:406-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599449Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1599450Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1599543Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 1599544Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 1599550Species Mouse (Mus musculus) [TaxId:10090] [82426] (9 PDB entries)
    Uniprot P47934
  8. 1599566Domain d1ndfa2: 1ndf A:406-625 [80417]
    complexed with 152

Details for d1ndfa2

PDB Entry: 1ndf (more details), 1.9 Å

PDB Description: Carnitine Acetyltransferase in Complex with Carnitine
PDB Compounds: (A:) carnitine acetyltransferase

SCOPe Domain Sequences for d1ndfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndfa2 c.43.1.3 (A:406-625) Carnitine acetyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
dldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqacatyesaslrmfhlgrt
dtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdrairgeafdrhllglkl
qaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmffgpvvpdgygicynpmeahi
nfsvsaynscaetnaarmahylekalldmrtllqnhprak

SCOPe Domain Coordinates for d1ndfa2:

Click to download the PDB-style file with coordinates for d1ndfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ndfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ndfa1