![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) ![]() |
![]() | Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Protein Carnitine acetyltransferase [82425] (2 species) relative spatial position of the domains is similar to the monomers in CAT trimer |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [82426] (9 PDB entries) Uniprot P47934 |
![]() | Domain d1ndfa2: 1ndf A:406-625 [80417] complexed with 152 |
PDB Entry: 1ndf (more details), 1.9 Å
SCOPe Domain Sequences for d1ndfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndfa2 c.43.1.3 (A:406-625) Carnitine acetyltransferase {Mouse (Mus musculus) [TaxId: 10090]} dldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqacatyesaslrmfhlgrt dtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdrairgeafdrhllglkl qaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmffgpvvpdgygicynpmeahi nfsvsaynscaetnaarmahylekalldmrtllqnhprak
Timeline for d1ndfa2: