Lineage for d1nb3.2 (1nb3 R:,B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926801Protein Cathepsin H [81637] (1 species)
    also contains a disulfide-bound minicathepsin H chain
  7. 2926802Species Pig (Sus scrofa) [TaxId:9823] [81636] (3 PDB entries)
  8. 2926809Domain d1nb3.2: 1nb3 R:,B: [80370]
    Other proteins in same PDB: d1nb3i_, d1nb3j_, d1nb3k_, d1nb3l_

Details for d1nb3.2

PDB Entry: 1nb3 (more details), 2.8 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
PDB Compounds: (B:) Cathepsin H, (R:) cathepsin h mini chain

SCOPe Domain Sequences for d1nb3.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1nb3.2 d.3.1.1 (R:,B:) Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]}
epqncsatXyppsmdwrkkgnfvspvknqgscgscwtfsttgalesavaiatgkmlslae
qqlvdcaqnfnnhgcqgglpsqafeyirynkgimgedtypykgqddhckfqpdkaiafvk
dvanitmndeeamveavalynpvsfafevtndflmyrkgiysstschktpdkvnhavlav
gygeengipywivknswgpqwgmngyfliergknmcglaacasypiplv

SCOPe Domain Coordinates for d1nb3.2:

Click to download the PDB-style file with coordinates for d1nb3.2.
(The format of our PDB-style files is described here.)

Timeline for d1nb3.2: