Lineage for d1nb3i_ (1nb3 I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935752Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2935758Protein Cystatin A (stefin A) [54412] (1 species)
  7. 2935759Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)
  8. 2935769Domain d1nb3i_: 1nb3 I: [80373]
    Other proteins in same PDB: d1nb3.1, d1nb3.2, d1nb3.3, d1nb3.4

Details for d1nb3i_

PDB Entry: 1nb3 (more details), 2.8 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
PDB Compounds: (I:) stefin a

SCOPe Domain Sequences for d1nb3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nb3i_ d.17.1.2 (I:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

SCOPe Domain Coordinates for d1nb3i_:

Click to download the PDB-style file with coordinates for d1nb3i_.
(The format of our PDB-style files is described here.)

Timeline for d1nb3i_: