| Class b: All beta proteins [48724] (119 folds) |
| Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (6 proteins) forms homo and heteroheptameric ring structures |
| Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries) |
| Domain d1n9sc_: 1n9s C: [80353] |
PDB Entry: 1n9s (more details), 3.5 Å
SCOP Domain Sequences for d1n9sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9sc_ b.38.1.1 (C:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae)}
vnpkpflkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeif
irsnnvlyirelpn
Timeline for d1n9sc_: