SCOP 1.63: Domain d1n91a_: 1n91 A:

Lineage for d1n91a_ (1n91 A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.206: YggU-like [69785] (1 superfamily)
   beta(2)-loop-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243; some similarity to the Homing endonuclease-like fold

4. Superfamily d.206.1: YggU-like [69786] (1 family)

5. Family d.206.1.1: YggU-like [69787] (2 proteins)

6. Protein Hypothetical protein YggU [82745] (1 species)

7. Species Escherichia coli, o157 [TaxId:562] [82746] (1 PDB entry)

8. Domain d1n91a_: 1n91 A: [80326]
   CASP5
   structural genomics protein

Details for d1n91a_

PDB Entry: 1n91

PDB Description: solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14.

SCOP Domain Sequences for d1n91a_:

Sequence; same for both SEQRES and ATOM records:

>d1n91a_ d.206.1.1 (A:) Hypothetical protein YggU {Escherichia coli, o157}
mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflg
kqfrvaksqvviekgelgrhkqikiinpqqippevaalinlehhhhhh

Timeline for d1n91a_:

• d1n91a_ is new in SCOP 1.63
  
• d1n91a_ appears in SCOP 1.65
  
• d1n91a_ appears in the current release, SCOPe 2.08, called d1n91a1