![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
![]() | Protein Protooncoprotein Her2 extracellular domain [82328] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [82330] (1 PDB entry) |
![]() | Domain d1n8yc2: 1n8y C:323-488 [80315] Other proteins in same PDB: d1n8yc3, d1n8yc4 complexed with nag |
PDB Entry: 1n8y (more details), 2.4 Å
SCOPe Domain Sequences for d1n8yc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} glgmehlrgaraitsdnvqefdgckkifgslaflpesfdgdpssgiaplrpeqlqvfetl eeitgylyisawpdslrdlsvfqnlriirgrilhdgaysltlqglgihslglrslrelgs glalihrnahlcfvhtvpwdqlfrnphqallhsgnrpeedcglegl
Timeline for d1n8yc2: