PDB entry 1n8y

View 1n8y on RCSB PDB site
Description: Crystal structure of the extracellular region of rat HER2
Class: transferase
Keywords: tyrosin kinase receptor, cell surface receptor, TRANSFERASE
Deposited on 2002-11-21, released 2003-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: protooncoprotein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: neu
    Database cross-references and differences (RAF-indexed):
    • GB AAM50093 (0-607)
    Domains in SCOPe 2.07: d1n8yc1, d1n8yc2, d1n8yc3, d1n8yc4
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n8yC (C:)
    tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltyvpanaslsflqdiqevqg
    ymliahnqvkrvplqrlrivrgtqlfedkyalavldnrdpqdnvaastpgrtpeglrelq
    lrslteilkggvlirgnpqlcyqdmvlwkdvfrknnqlapvdidtnrsracppcapackd
    nhcwgespedcqiltgtictsgcarckgrlptdccheqcaagctgpkhsdclaclhfnhs
    gicelhcpalvtyntdtfesmhnpegrytfgascvttcpynylstevgsctlvcppnnqe
    vtaedgtqrcekcskpcarvcyglgmehlrgaraitsdnvqefdgckkifgslaflpesf
    dgdpssgiaplrpeqlqvfetleeitgylyisawpdslrdlsvfqnlriirgrilhdgay
    sltlqglgihslglrslrelgsglalihrnahlcfvhtvpwdqlfrnphqallhsgnrpe
    edcgleglvcnslcahghcwgpgptqcvncshflrgqecveecrvwkglpreyvsdkrcl
    pchpecqpqnssetcfgseadqcaacahykdssscvarcpsgvkpdlsympiwkypdeeg
    icqpcpin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8yC (C:)
    tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltyvpanaslsflqdiqevqg
    ymliahnqvkrvplqrlrivrgtqlfedkyalavldnrdpqpeglrelqlrslteilkgg
    vlirgnpqlcyqdmvlwkdvfrknnqlapvdidtnrsracppcapackdnhcwgespedc
    qiltgtictsgcarckgrlptdccheqcaagctgpkhsdclaclhfnhsgicelhcpalv
    tyesmhnpegrytfgascvttcpynylstevgsctlvcppnnqevtaedgtqrcekcskp
    carvcyglgmehlrgaraitsdnvqefdgckkifgslaflpesfdgdpssgiaplrpeql
    qvfetleeitgylyisawpdslrdlsvfqnlriirgrilhdgaysltlqglgihslglrs
    lrelgsglalihrnahlcfvhtvpwdqlfrnphqallhsgnrpeedcgleglvcnslcah
    ghcwgpgptqcvncshflrgqecveecrvwkglpreyvsdkrclpchpecqpqnssetcf
    gseadqcaacahykdssscvarcpsgvkpdlsympiwkypdeegicqpcpin