Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
Domain d1n8ef2: 1n8e F:97-141 [80296] Other proteins in same PDB: d1n8ea_, d1n8eb1, d1n8eb2, d1n8ec1, d1n8ed_, d1n8ee1, d1n8ee2, d1n8ef1 coiled-coil region only |
PDB Entry: 1n8e (more details), 4.5 Å
SCOPe Domain Sequences for d1n8ef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8ef2 h.1.8.1 (F:97-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d1n8ef2: