SCOPe 2.06: Domain d1n8eb1: 1n8e B:200-457

Lineage for d1n8eb1 (1n8e B:200-457)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
   automatically mapped to Pfam PF00147

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
   Uniprot P02675

8. Domain d1n8eb1: 1n8e B:200-457 [80288]
   Other proteins in same PDB: d1n8ea_, d1n8eb2, d1n8ec2, d1n8ed_, d1n8ee2, d1n8ef2

Details for d1n8eb1

PDB Entry: 1n8e, 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

PDB Compounds: (B:) Fibrin beta chain

SCOPe Domain Sequences for d1n8eb1:

Sequence; same for both SEQRES and ATOM records:

>d1n8eb1 d.171.1.1 (B:200-457) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpf

Timeline for d1n8eb1:

• d1n8eb1 first appeared in SCOP 1.63
  
• d1n8eb1 appears in SCOPe 2.05
  
• d1n8eb1 appears in SCOPe 2.07
  
• d1n8eb1 appears in the current release, SCOPe 2.08